Lineage for d1sqqb1 (1sqq B:18-235)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1444881Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1444882Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1444883Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 1444958Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 1444987Species Cow (Bos taurus) [TaxId:9913] [56000] (18 PDB entries)
    Uniprot P23004
  8. 1445020Domain d1sqqb1: 1sqq B:18-235 [119009]
    Other proteins in same PDB: d1sqqa1, d1sqqa2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqf1, d1sqqg1, d1sqqh1, d1sqqi1, d1sqqj1, d1sqqk1
    automatically matched to d1bccb1
    complexed with fes, hem, ost, uq2

Details for d1sqqb1

PDB Entry: 1sqq (more details), 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
PDB Compounds: (B:) Ubiquinol-cytochrome-c reductase complex core protein 2, mitochondrial precursor

SCOPe Domain Sequences for d1sqqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqqb1 d.185.1.1 (B:18-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]}
pphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlassltt
kgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwev
aalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvqn
hftsarmaliglgvshpvlkqvaeqflnirgglglsga

SCOPe Domain Coordinates for d1sqqb1:

Click to download the PDB-style file with coordinates for d1sqqb1.
(The format of our PDB-style files is described here.)

Timeline for d1sqqb1: