| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
| Family d.185.1.1: MPP-like [63412] (6 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
| Protein Cytochrome bc1 core subunit 1 [63408] (3 species) |
| Species Cow (Bos taurus) [TaxId:9913] [55997] (18 PDB entries) Uniprot P31800 |
| Domain d1sqqa2: 1sqq A:234-446 [119008] Other proteins in same PDB: d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqf1, d1sqqg1, d1sqqh1, d1sqqi1, d1sqqj1, d1sqqk1 automatically matched to d1be3a2 complexed with fes, hem, ost, uq2 |
PDB Entry: 1sqq (more details), 3 Å
SCOP Domain Sequences for d1sqqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqqa2 d.185.1.1 (A:234-446) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]}
crftgsqichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssp
lasiaatnklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatese
vlrgknllrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcsk
yfydqcpavagfgpieqlpdynrirsgmfwlrf
Timeline for d1sqqa2: