Lineage for d1sqqa2 (1sqq A:234-446)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879393Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 879394Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 879395Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 879396Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 879425Species Cow (Bos taurus) [TaxId:9913] [55997] (18 PDB entries)
    Uniprot P31800
  8. 879459Domain d1sqqa2: 1sqq A:234-446 [119008]
    Other proteins in same PDB: d1sqqb1, d1sqqb2, d1sqqc1, d1sqqc2, d1sqqd1, d1sqqd2, d1sqqf1, d1sqqg1, d1sqqh1, d1sqqi1, d1sqqj1, d1sqqk1
    automatically matched to d1be3a2
    complexed with fes, hem, ost, uq2

Details for d1sqqa2

PDB Entry: 1sqq (more details), 3 Å

PDB Description: crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
PDB Compounds: (A:) Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial precursor

SCOP Domain Sequences for d1sqqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqqa2 d.185.1.1 (A:234-446) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]}
crftgsqichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssp
lasiaatnklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatese
vlrgknllrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcsk
yfydqcpavagfgpieqlpdynrirsgmfwlrf

SCOP Domain Coordinates for d1sqqa2:

Click to download the PDB-style file with coordinates for d1sqqa2.
(The format of our PDB-style files is described here.)

Timeline for d1sqqa2: