Lineage for d1sqpj1 (1sqp J:1-61)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745533Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 745953Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
  5. 745954Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein)
  6. 745955Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    interacts with cytochrome c1 and ISP
  7. 745967Species Cow (Bos taurus) [TaxId:9913] [81509] (18 PDB entries)
  8. 745982Domain d1sqpj1: 1sqp J:1-61 [119006]
    Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpg1, d1sqph1, d1sqpi1
    automatically matched to d1be3j_
    complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqpj1

PDB Entry: 1sqp (more details), 2.7 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Myxothiazol
PDB Compounds: (J:) Ubiquinol-cytochrome c reductase complex 7.2 kDa protein

SCOP Domain Sequences for d1sqpj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqpj1 f.23.14.1 (J:1-61) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
n

SCOP Domain Coordinates for d1sqpj1:

Click to download the PDB-style file with coordinates for d1sqpj1.
(The format of our PDB-style files is described here.)

Timeline for d1sqpj1: