SCOP 1.73: Domain d1sqpi1: 1sqp I:1-57

Lineage for d1sqpi1 (1sqp I:1-57)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
   not a true fold

4. Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families)
   not a true superfamily

5. Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (1 protein)
   beta-hairpin and a short alpha-helix bound to the core subunits

6. Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [90079] (14 PDB entries)
   there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop

8. Domain d1sqpi1: 1sqp I:1-57 [119005]
   Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpg1, d1sqph1, d1sqpj1
   automatically matched to d1l0li_
   complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqpi1

PDB Entry: 1sqp, 2.7 Å

PDB Description: crystal structure analysis of bovine bc1 with myxothiazol

PDB Compounds: (I:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]

SCOP Domain Sequences for d1sqpi1:

Sequence; same for both SEQRES and ATOM records:

>d1sqpi1 d.184.1.3 (I:1-57) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus) [TaxId: 9913]}
mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg

Timeline for d1sqpi1:

• d1sqpi1 is new in SCOP 1.73
  
• d1sqpi1 appears in SCOP 1.75
  
• d1sqpi1 appears in the current release, SCOPe 2.08, called d1sqpi_