Lineage for d1sqph_ (1sqp H:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1458108Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1458109Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
    automatically mapped to Pfam PF02320
  5. 1458110Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 1458144Protein automated matches [190042] (2 species)
    not a true protein
  7. 1458154Species Cow (Bos taurus) [TaxId:9913] [186764] (5 PDB entries)
  8. 1458160Domain d1sqph_: 1sqp H: [119004]
    Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpe1, d1sqpe2, d1sqpf1, d1sqpg_, d1sqpi_, d1sqpj_, d1sqpk1
    automated match to d1l0lh_
    complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqph_

PDB Entry: 1sqp (more details), 2.7 Å

PDB Description: crystal structure analysis of bovine bc1 with myxothiazol
PDB Compounds: (H:) Ubiquinol-cytochrome c reductase complex 11 kDa protein

SCOPe Domain Sequences for d1sqph_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqph_ f.28.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
elvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvah
klfnslk

SCOPe Domain Coordinates for d1sqph_:

Click to download the PDB-style file with coordinates for d1sqph_.
(The format of our PDB-style files is described here.)

Timeline for d1sqph_: