SCOP 1.73: Domain d1sqph1: 1sqp H:12-78

Lineage for d1sqph1 (1sqp H:12-78)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family)
   location - intermembrane side of the bc1 complex

5. Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (1 protein)
   "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1

6. Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81526] (18 PDB entries)

8. Domain d1sqph1: 1sqp H:12-78 [119004]
   Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpg1, d1sqpi1, d1sqpj1
   automatically matched to d1l0lh_
   complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqph1

PDB Entry: 1sqp, 2.7 Å

PDB Description: crystal structure analysis of bovine bc1 with myxothiazol

PDB Compounds: (H:) Ubiquinol-cytochrome c reductase complex 11 kDa protein

SCOP Domain Sequences for d1sqph1:

Sequence; same for both SEQRES and ATOM records:

>d1sqph1 f.28.1.1 (H:12-78) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
elvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvah
klfnslk

Timeline for d1sqph1:

• d1sqph1 is new in SCOP 1.73
  
• d1sqph1 appears in SCOP 1.75
  
• d1sqph1 appears in the current release, SCOPe 2.08, called d1sqph_