Lineage for d1sqpg1 (1sqp G:1-75)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745533Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 745916Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
  5. 745917Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein)
  6. 745918Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
    together with cytochrome b binds to ubiquinone
  7. 745930Species Cow (Bos taurus) [TaxId:9913] [81503] (18 PDB entries)
  8. 745946Domain d1sqpg1: 1sqp G:1-75 [119003]
    Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqph1, d1sqpi1, d1sqpj1
    automatically matched to d1be3g_
    complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqpg1

PDB Entry: 1sqp (more details), 2.7 Å

PDB Description: crystal structure analysis of bovine bc1 with myxothiazol
PDB Compounds: (G:) ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c

SCOP Domain Sequences for d1sqpg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqpg1 f.23.13.1 (G:1-75) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpa

SCOP Domain Coordinates for d1sqpg1:

Click to download the PDB-style file with coordinates for d1sqpg1.
(The format of our PDB-style files is described here.)

Timeline for d1sqpg1: