![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) ![]() |
![]() | Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein) |
![]() | Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81491] (18 PDB entries) Uniprot P00125 |
![]() | Domain d1sqpd2: 1sqp D:196-241 [119002] Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpe1, d1sqpe2, d1sqpf1, d1sqpg_, d1sqph_, d1sqpi_, d1sqpj_, d1sqpk1 automated match to d1ppjd2 complexed with cdl, fes, hem, myx, pee, plx |
PDB Entry: 1sqp (more details), 2.7 Å
SCOPe Domain Sequences for d1sqpd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqpd2 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]} pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk
Timeline for d1sqpd2: