SCOPe 2.04: Domain d1sqpd1: 1sqp D:1-195

Lineage for d1sqpd1 (1sqp D:1-195)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)

6. Protein Cytochrome bc1 domain [46677] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [46678] (17 PDB entries)
   Uniprot P00125

8. Domain d1sqpd1: 1sqp D:1-195 [119001]
   Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd2, d1sqpe1, d1sqpe2, d1sqpf1, d1sqpg_, d1sqph_, d1sqpi_, d1sqpj_, d1sqpk1
   automated match to d1ppjd1
   complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqpd1

PDB Entry: 1sqp, 2.7 Å

PDB Description: crystal structure analysis of bovine bc1 with myxothiazol

PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d1sqpd1:

Sequence; same for both SEQRES and ATOM records:

>d1sqpd1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

Timeline for d1sqpd1:

• d1sqpd1 first appeared in SCOP 1.73
  
• d1sqpd1 appears in SCOPe 2.03
  
• d1sqpd1 appears in SCOPe 2.05
  
• d1sqpd1 appears in the current release, SCOPe 2.08