SCOPe 2.01: Domain d1sqpc2: 1sqp C:2-260

Lineage for d1sqpc2 (1sqp C:2-260)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
   also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits

7. Species Cow (Bos taurus) [TaxId:9913] [81638] (17 PDB entries)
   Uniprot P00157

8. Domain d1sqpc2: 1sqp C:2-260 [119000]
   Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpd1, d1sqpd2, d1sqpf1, d1sqpg_, d1sqph_, d1sqpi1, d1sqpj_, d1sqpk1
   automatically matched to d1be3c3
   complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqpc2

PDB Entry: 1sqp, 2.7 Å

PDB Description: crystal structure analysis of bovine bc1 with myxothiazol

PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d1sqpc2:

Sequence; same for both SEQRES and ATOM records:

>d1sqpc2 f.21.1.2 (C:2-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
tnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttt
afssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilll
tvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffaf
hfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalml
lvlfapdllgdpdnytpan

Timeline for d1sqpc2:

• d1sqpc2 first appeared in SCOP 1.73
  
• d1sqpc2 appears in SCOP 1.75
  
• d1sqpc2 appears in SCOPe 2.02
  
• d1sqpc2 appears in the current release, SCOPe 2.08