![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
![]() | Protein Cytochrome bc1 core subunit 2 [63409] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [56000] (17 PDB entries) Uniprot P23004 |
![]() | Domain d1sqpb1: 1sqp B:17-235 [118997] Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpe1, d1sqpe2, d1sqpf1, d1sqpg_, d1sqph_, d1sqpi_, d1sqpj_, d1sqpk1 automated match to d1sqbb1 complexed with cdl, fes, hem, myx, pee, plx |
PDB Entry: 1sqp (more details), 2.7 Å
SCOPe Domain Sequences for d1sqpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqpb1 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]} vpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslt tkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwe vaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvq nhftsarmaliglgvshpvlkqvaeqflnirgglglsga
Timeline for d1sqpb1: