SCOPe 2.01: Domain d1sqpb1: 1sqp B:18-235

Lineage for d1sqpb1 (1sqp B:18-235)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (6 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 2 [63409] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [56001] (9 PDB entries)

8. Domain d1sqpb1: 1sqp B:18-235 [118997]
   Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpf1, d1sqpg_, d1sqph_, d1sqpi1, d1sqpj_, d1sqpk1
   automatically matched to d1bccb1
   complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqpb1

PDB Entry: 1sqp, 2.7 Å

PDB Description: crystal structure analysis of bovine bc1 with myxothiazol

PDB Compounds: (B:) Ubiquinol-cytochrome-c reductase complex core protein 2, mitochondrial precursor

SCOPe Domain Sequences for d1sqpb1:

Sequence; same for both SEQRES and ATOM records:

>d1sqpb1 d.185.1.1 (B:18-235) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus) [TaxId: 9031]}
pphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlassltt
kgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwev
aalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvqn
hftsarmaliglgvshpvlkqvaeqflnirgglglsga

Timeline for d1sqpb1:

• d1sqpb1 first appeared in SCOP 1.73
  
• d1sqpb1 appears in SCOP 1.75
  
• d1sqpb1 appears in SCOPe 2.02
  
• d1sqpb1 appears in the current release, SCOPe 2.08