Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
Family d.185.1.1: MPP-like [63412] (6 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
Protein Cytochrome bc1 core subunit 2 [63409] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [56001] (9 PDB entries) |
Domain d1sqpb1: 1sqp B:18-235 [118997] Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpf1, d1sqpg_, d1sqph_, d1sqpi1, d1sqpj_, d1sqpk1 automatically matched to d1bccb1 complexed with cdl, fes, hem, myx, pee, plx |
PDB Entry: 1sqp (more details), 2.7 Å
SCOPe Domain Sequences for d1sqpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqpb1 d.185.1.1 (B:18-235) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus) [TaxId: 9031]} pphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlassltt kgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwev aalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvqn hftsarmaliglgvshpvlkqvaeqflnirgglglsga
Timeline for d1sqpb1: