Lineage for d1sqpb1 (1sqp B:18-235)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739189Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 739190Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 739191Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 739258Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 739272Species Chicken (Gallus gallus) [TaxId:9031] [56001] (9 PDB entries)
  8. 739283Domain d1sqpb1: 1sqp B:18-235 [118997]
    Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpg1, d1sqph1, d1sqpi1, d1sqpj1
    automatically matched to d1bccb1
    complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqpb1

PDB Entry: 1sqp (more details), 2.7 Å

PDB Description: crystal structure analysis of bovine bc1 with myxothiazol
PDB Compounds: (B:) Ubiquinol-cytochrome-c reductase complex core protein 2, mitochondrial precursor

SCOP Domain Sequences for d1sqpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqpb1 d.185.1.1 (B:18-235) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus) [TaxId: 9031]}
pphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlassltt
kgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwev
aalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvqn
hftsarmaliglgvshpvlkqvaeqflnirgglglsga

SCOP Domain Coordinates for d1sqpb1:

Click to download the PDB-style file with coordinates for d1sqpb1.
(The format of our PDB-style files is described here.)

Timeline for d1sqpb1: