Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (9 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (9 proteins) |
Protein Non-hem ferritin [63524] (4 species) |
Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [140432] (2 PDB entries) Uniprot O29424 3-164 |
Domain d1sq3j1: 1sq3 J:3-164 [118992] automatically matched to 1S3Q A:3-164 complexed with fe |
PDB Entry: 1sq3 (more details), 2.7 Å
SCOP Domain Sequences for d1sq3j1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sq3j1 a.25.1.1 (J:3-164) Non-hem ferritin {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
Timeline for d1sq3j1: