Class a: All alpha proteins [46456] (285 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Bacterioferritin (cytochrome b1) [47244] (5 species) binds heme between two subunits; 24-mer |
Species Azotobacter vinelandii [TaxId:354] [140431] (1 PDB entry) Uniprot P22759 1-155 |
Domain d1sofa1: 1sof A:1-154 [118973] Other proteins in same PDB: d1sofb_, d1sofc_, d1sofd_, d1sofe_, d1soff_, d1sofg_, d1sofh_ complexed with ba, fe2, hem, mg |
PDB Entry: 1sof (more details), 2.6 Å
SCOPe Domain Sequences for d1sofa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sofa1 a.25.1.1 (A:1-154) Bacterioferritin (cytochrome b1) {Azotobacter vinelandii [TaxId: 354]} mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell edileseedhidwletqldlidkiglenylqsqm
Timeline for d1sofa1: