Lineage for d1sofa1 (1sof A:1-154)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701406Protein Bacterioferritin (cytochrome b1) [47244] (6 species)
    binds heme between two subunits; 24-mer
  7. 2701407Species Azotobacter vinelandii [TaxId:354] [140431] (1 PDB entry)
    Uniprot P22759 1-155
  8. 2701408Domain d1sofa1: 1sof A:1-154 [118973]
    Other proteins in same PDB: d1sofb_, d1sofc_, d1sofd_, d1sofe_, d1soff_, d1sofg_, d1sofh_
    complexed with ba, fe2, hem, mg

Details for d1sofa1

PDB Entry: 1sof (more details), 2.6 Å

PDB Description: Crystal structure of the azotobacter vinelandii bacterioferritin at 2.6 A resolution
PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d1sofa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sofa1 a.25.1.1 (A:1-154) Bacterioferritin (cytochrome b1) {Azotobacter vinelandii [TaxId: 354]}
mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
edileseedhidwletqldlidkiglenylqsqm

SCOPe Domain Coordinates for d1sofa1:

Click to download the PDB-style file with coordinates for d1sofa1.
(The format of our PDB-style files is described here.)

Timeline for d1sofa1: