Lineage for d1s9fc1 (1s9f C:241-341)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 881225Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 881226Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) (S)
  5. 881227Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 881228Protein DinB homolog (DBH) [100881] (3 species)
  7. 881233Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (50 PDB entries)
  8. 881237Domain d1s9fc1: 1s9f C:241-341 [118917]
    Other proteins in same PDB: d1s9fa2, d1s9fb2, d1s9fc2, d1s9fd2
    automatically matched to d1n48a1
    complexed with ca, ddy, mg

Details for d1s9fc1

PDB Entry: 1s9f (more details), 2 Å

PDB Description: DPO with AT matched
PDB Compounds: (C:) DNA polymerase IV

SCOP Domain Sequences for d1s9fc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9fc1 d.240.1.1 (C:241-341) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

SCOP Domain Coordinates for d1s9fc1:

Click to download the PDB-style file with coordinates for d1s9fc1.
(The format of our PDB-style files is described here.)

Timeline for d1s9fc1: