Lineage for d1s73a_ (1s73 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1275305Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1275306Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1275307Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 1275326Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 1275327Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (170 PDB entries)
    Uniprot P00431
  8. 1275376Domain d1s73a_: 1s73 A: [118876]
    automated match to d1koka_
    complexed with fmi

Details for d1s73a_

PDB Entry: 1s73 (more details), 1.53 Å

PDB Description: Crystal Structure of Mesopone Cytochrome c Peroxidase (R-isomer) [MpCcP-R]
PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d1s73a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s73a_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d1s73a_:

Click to download the PDB-style file with coordinates for d1s73a_.
(The format of our PDB-style files is described here.)

Timeline for d1s73a_: