Lineage for d1s5ze_ (1s5z E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951327Protein automated matches [190032] (18 species)
    not a true protein
  7. 2951533Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [186756] (3 PDB entries)
  8. 2951545Domain d1s5ze_: 1s5z E: [118872]
    automated match to d1f6tb_
    complexed with po4, son

Details for d1s5ze_

PDB Entry: 1s5z (more details), 2 Å

PDB Description: NDP kinase in complex with adenosine phosphonoacetic acid
PDB Compounds: (E:) Nucleoside diphosphate kinase, cytosolic

SCOPe Domain Sequences for d1s5ze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5ze_ d.58.6.1 (E:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
svesanreialwfkpeelltevkpnpnlye

SCOPe Domain Coordinates for d1s5ze_:

Click to download the PDB-style file with coordinates for d1s5ze_.
(The format of our PDB-style files is described here.)

Timeline for d1s5ze_: