Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (19 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:2234] [186755] (1 PDB entry) |
Domain d1s3qb_: 1s3q B: [118849] Other proteins in same PDB: d1s3qa1 automated match to d1vlga_ complexed with zn |
PDB Entry: 1s3q (more details), 2.1 Å
SCOPe Domain Sequences for d1s3qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s3qb_ a.25.1.0 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
Timeline for d1s3qb_: