SCOPe 2.07: Domain d1rc1b_: 1rc1 B:

Lineage for d1rc1b_ (1rc1 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest

4. Superfamily c.65.1: Formyltransferase [53328] (2 families)

5. Family c.65.1.1: Formyltransferase [53329] (5 proteins)

6. Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82468] (30 PDB entries)

8. Domain d1rc1b_: 1rc1 B: [118768]
   automated match to d1meoa_
   complexed with kt3, po4

Details for d1rc1b_

PDB Entry: 1rc1, 2.25 Å

PDB Description: Human GAR Tfase complex structure with polyglutamated 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid

PDB Compounds: (B:) phosphoribosylglycinamide formyltransferase

SCOPe Domain Sequences for d1rc1b_:

Sequence; same for both SEQRES and ATOM records:

>d1rc1b_ c.65.1.1 (B:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]}
arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
lqlvasgtvqlgengkicwv

Timeline for d1rc1b_:

• d1rc1b_ first appeared in SCOP 1.73, called d1rc1b1
  
• d1rc1b_ appears in SCOPe 2.06
  
• d1rc1b_ appears in the current release, SCOPe 2.08