Lineage for d1rbmb1 (1rbm B:1-200)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 839503Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 839504Superfamily c.65.1: Formyltransferase [53328] (1 family) (S)
  5. 839505Family c.65.1.1: Formyltransferase [53329] (4 proteins)
  6. 839512Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)
  7. 839534Species Human (Homo sapiens) [TaxId:9606] [82468] (12 PDB entries)
  8. 839561Domain d1rbmb1: 1rbm B:1-200 [118754]
    automatically matched to d1meoa_
    complexed with kt5, po4

Details for d1rbmb1

PDB Entry: 1rbm (more details), 2.3 Å

PDB Description: Human GAR Tfase complex structure with polyglutamated 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid
PDB Compounds: (B:) phosphoribosylglycinamide formyltransferase

SCOP Domain Sequences for d1rbmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rbmb1 c.65.1.1 (B:1-200) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]}
arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
lqlvasgtvqlgengkicwv

SCOP Domain Coordinates for d1rbmb1:

Click to download the PDB-style file with coordinates for d1rbmb1.
(The format of our PDB-style files is described here.)

Timeline for d1rbmb1: