![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.45: ClpS-like [54735] (1 superfamily) beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta |
![]() | Superfamily d.45.1: ClpS-like [54736] (3 families) ![]() |
![]() | Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins) |
![]() | Protein automated matches [190034] (3 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [186753] (2 PDB entries) |
![]() | Domain d1r6qc_: 1r6q C: [118742] Other proteins in same PDB: d1r6qa_, d1r6qb_ automated match to d1lzwa_ complexed with gol, y1, ybt |
PDB Entry: 1r6q (more details), 2.35 Å
SCOPe Domain Sequences for d1r6qc_:
Sequence, based on SEQRES records: (download)
>d1r6qc_ d.45.1.2 (C:) automated matches {Escherichia coli [TaxId: 562]} wldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavh yqgkaicgvftaevaetkvamvnkyarenehpllctleka
>d1r6qc_ d.45.1.2 (C:) automated matches {Escherichia coli [TaxId: 562]} wldfdqldalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkai cgvftaevaetkvamvnkyarenehpllctleka
Timeline for d1r6qc_: