Lineage for d1r6qc_ (1r6q C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190278Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 2190279Superfamily d.45.1: ClpS-like [54736] (3 families) (S)
  5. 2190303Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins)
  6. 2190324Protein automated matches [190034] (3 species)
    not a true protein
  7. 2190339Species Escherichia coli [TaxId:562] [186753] (2 PDB entries)
  8. 2190342Domain d1r6qc_: 1r6q C: [118742]
    Other proteins in same PDB: d1r6qa_, d1r6qb_
    automated match to d1lzwa_
    complexed with gol, y1, ybt

Details for d1r6qc_

PDB Entry: 1r6q (more details), 2.35 Å

PDB Description: ClpNS with fragments
PDB Compounds: (C:) ATP-dependent Clp protease adaptor protein clpS

SCOPe Domain Sequences for d1r6qc_:

Sequence, based on SEQRES records: (download)

>d1r6qc_ d.45.1.2 (C:) automated matches {Escherichia coli [TaxId: 562]}
wldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavh
yqgkaicgvftaevaetkvamvnkyarenehpllctleka

Sequence, based on observed residues (ATOM records): (download)

>d1r6qc_ d.45.1.2 (C:) automated matches {Escherichia coli [TaxId: 562]}
wldfdqldalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkai
cgvftaevaetkvamvnkyarenehpllctleka

SCOPe Domain Coordinates for d1r6qc_:

Click to download the PDB-style file with coordinates for d1r6qc_.
(The format of our PDB-style files is described here.)

Timeline for d1r6qc_: