SCOP 1.75: Domain d1r6qc1: 1r6q C:20-106

Lineage for d1r6qc1 (1r6q C:20-106)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.45: ClpS-like [54735] (1 superfamily)
   beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta

4. Superfamily d.45.1: ClpS-like [54736] (2 families)

5. Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (1 protein)

6. Protein Adaptor protein ClpS (YljA) [82642] (1 species)

7. Species Escherichia coli [TaxId:562] [82643] (7 PDB entries)

8. Domain d1r6qc1: 1r6q C:20-106 [118742]
   Other proteins in same PDB: d1r6qa1, d1r6qb1
   automatically matched to d1mbxc_
   complexed with gol, y1, ybt

Details for d1r6qc1

PDB Entry: 1r6q, 2.35 Å

PDB Description: ClpNS with fragments

PDB Compounds: (C:) ATP-dependent Clp protease adaptor protein clpS

SCOP Domain Sequences for d1r6qc1:

Sequence; same for both SEQRES and ATOM records:

>d1r6qc1 d.45.1.2 (C:20-106) Adaptor protein ClpS (YljA) {Escherichia coli [TaxId: 562]}
dalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftae
vaetkvamvnkyarenehpllctleka

Timeline for d1r6qc1:

• d1r6qc1 first appeared in SCOP 1.73
  
• d1r6qc1 is called d1r6qc_ in SCOPe 2.01
  
• d1r6qc1 appears in the current release, SCOPe 2.08, called d1r6qc_