Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.45: ClpS-like [54735] (1 superfamily) beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta |
Superfamily d.45.1: ClpS-like [54736] (2 families) |
Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (1 protein) |
Protein Adaptor protein ClpS (YljA) [82642] (1 species) |
Species Escherichia coli [TaxId:562] [82643] (7 PDB entries) |
Domain d1r6qc1: 1r6q C:20-106 [118742] Other proteins in same PDB: d1r6qa1, d1r6qb1 automatically matched to d1mbxc_ complexed with gol, y1, ybt |
PDB Entry: 1r6q (more details), 2.35 Å
SCOP Domain Sequences for d1r6qc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r6qc1 d.45.1.2 (C:20-106) Adaptor protein ClpS (YljA) {Escherichia coli [TaxId: 562]} dalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftae vaetkvamvnkyarenehpllctleka
Timeline for d1r6qc1: