Lineage for d1r6qc1 (1r6q C:20-106)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722358Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 722359Superfamily d.45.1: ClpS-like [54736] (2 families) (S)
  5. 722381Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (1 protein)
  6. 722382Protein Adaptor protein ClpS (YljA) [82642] (1 species)
  7. 722383Species Escherichia coli [TaxId:562] [82643] (7 PDB entries)
  8. 722388Domain d1r6qc1: 1r6q C:20-106 [118742]
    Other proteins in same PDB: d1r6qa1, d1r6qb1
    automatically matched to d1mbxc_
    complexed with gol, y1, ybt

Details for d1r6qc1

PDB Entry: 1r6q (more details), 2.35 Å

PDB Description: ClpNS with fragments
PDB Compounds: (C:) ATP-dependent Clp protease adaptor protein clpS

SCOP Domain Sequences for d1r6qc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6qc1 d.45.1.2 (C:20-106) Adaptor protein ClpS (YljA) {Escherichia coli [TaxId: 562]}
dalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftae
vaetkvamvnkyarenehpllctleka

SCOP Domain Coordinates for d1r6qc1:

Click to download the PDB-style file with coordinates for d1r6qc1.
(The format of our PDB-style files is described here.)

Timeline for d1r6qc1: