Lineage for d1r6od1 (1r6o D:21-106)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859729Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 859730Superfamily d.45.1: ClpS-like [54736] (2 families) (S)
  5. 859754Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (1 protein)
  6. 859755Protein Adaptor protein ClpS (YljA) [82642] (1 species)
  7. 859756Species Escherichia coli [TaxId:562] [82643] (7 PDB entries)
  8. 859758Domain d1r6od1: 1r6o D:21-106 [118739]
    Other proteins in same PDB: d1r6oa1, d1r6ob1
    automatically matched to d1mbxc_
    complexed with cl, gol, y1, ybt, zn

Details for d1r6od1

PDB Entry: 1r6o (more details), 2.25 Å

PDB Description: ATP-dependent Clp protease ATP-binding subunit clpA/ATP-dependent Clp protease adaptor protein clpS
PDB Compounds: (D:) ATP-dependent Clp protease adaptor protein clpS

SCOP Domain Sequences for d1r6od1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6od1 d.45.1.2 (D:21-106) Adaptor protein ClpS (YljA) {Escherichia coli [TaxId: 562]}
alkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaev
aetkvamvnkyarenehpllctleka

SCOP Domain Coordinates for d1r6od1:

Click to download the PDB-style file with coordinates for d1r6od1.
(The format of our PDB-style files is described here.)

Timeline for d1r6od1: