![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.1: MPP-like [63412] (6 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
![]() | Protein Protease III [143500] (1 species) duplication: comprises four domains of this fold |
![]() | Species Escherichia coli [TaxId:562] [143501] (1 PDB entry) Uniprot P05458 24-263! Uniprot P05458 264-503! Uniprot P05458 504-732! Uniprot P05458 733-960 |
![]() | Domain d1q2la4: 1q2l A:24-263 [118734] complexed with pt, zn |
PDB Entry: 1q2l (more details), 2.2 Å
SCOP Domain Sequences for d1q2la4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q2la4 d.185.1.1 (A:24-263) Protease III {Escherichia coli [TaxId: 562]} etgwqpiqetirksdkdnrqyqairldngmvvllvsdpqavkslsalvvpvgsledpeay qglahylehmslmgskkypqadslaeylkmhggshnastapyrtafylevendalpgavd rladaiaeplldkkyaerernavnaeltmartrdgmrmaqvsaetinpahpgskfsggnl etlsdkpgnpvqqalkdfhekyysanlmkaviysnkplpelakmaadtfgrvpnkeskkp
Timeline for d1q2la4: