Class a: All alpha proteins [46456] (258 folds) |
Fold a.60: SAM domain-like [47768] (15 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) |
Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (15 proteins) |
Protein Polycomb protein Scm [140620] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140621] (2 PDB entries) |
Domain d1pk1d1: 1pk1 D:17-79 [118714] Other proteins in same PDB: d1pk1a1, d1pk1c1 automatically matched to 1PK1 B:17-79 mutant |
PDB Entry: 1pk1 (more details), 1.8 Å
SCOP Domain Sequences for d1pk1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pk1d1 a.60.1.2 (D:17-79) Polycomb protein Scm {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} wtieeviqyiesndnslavhgdlfrkheidgkallrlnsermmkymglklgpalkicnlv nkv
Timeline for d1pk1d1: