SCOP 1.73: Domain d1pk1d1: 1pk1 D:17-79

Lineage for d1pk1d1 (1pk1 D:17-79)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.60: SAM domain-like [47768] (15 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (2 families)

5. Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (15 proteins)

6. Protein Polycomb protein Scm [140620] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140621] (2 PDB entries)

8. Domain d1pk1d1: 1pk1 D:17-79 [118714]
   Other proteins in same PDB: d1pk1a1, d1pk1c1
   automatically matched to 1PK1 B:17-79
   mutant

Details for d1pk1d1

PDB Entry: 1pk1, 1.8 Å

PDB Description: hetero sam domain structure of ph and scm.

PDB Compounds: (D:) Sex comb on midleg CG9495-PA

SCOP Domain Sequences for d1pk1d1:

Sequence; same for both SEQRES and ATOM records:

>d1pk1d1 a.60.1.2 (D:17-79) Polycomb protein Scm {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
wtieeviqyiesndnslavhgdlfrkheidgkallrlnsermmkymglklgpalkicnlv
nkv

Timeline for d1pk1d1:

• d1pk1d1 is new in SCOP 1.73
  
• d1pk1d1 appears in SCOP 1.75
  
• d1pk1d1 appears in the current release, SCOPe 2.08, called d1pk1d_