Class b: All beta proteins [48724] (174 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins) |
Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
Species Thermus aquaticus [TaxId:271] [50469] (5 PDB entries) |
Domain d1ob5e2: 1ob5 E:313-405 [118698] Other proteins in same PDB: d1ob5a1, d1ob5a3, d1ob5c1, d1ob5c3, d1ob5e1, d1ob5e3 automatically matched to d1aipa2 protein/RNA complex; complexed with enx, gnp, mg |
PDB Entry: 1ob5 (more details), 3.1 Å
SCOPe Domain Sequences for d1ob5e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ob5e2 b.44.1.1 (E:313-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus [TaxId: 271]} htkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv elikpvaleeglrfaireggrtvgagvvtkile
Timeline for d1ob5e2: