Lineage for d1ob5e2 (1ob5 E:313-405)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1317759Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1317760Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1317761Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. 1317789Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 1317809Species Thermus aquaticus [TaxId:271] [50469] (5 PDB entries)
  8. 1317820Domain d1ob5e2: 1ob5 E:313-405 [118698]
    Other proteins in same PDB: d1ob5a1, d1ob5a3, d1ob5c1, d1ob5c3, d1ob5e1, d1ob5e3
    automatically matched to d1aipa2
    protein/RNA complex; complexed with enx, gnp, mg

Details for d1ob5e2

PDB Entry: 1ob5 (more details), 3.1 Å

PDB Description: t. aquaticus elongation factor ef-tu complexed with the antibiotic enacyloxin iia, a gtp analog, and phe-trna
PDB Compounds: (E:) elongation factor tu

SCOPe Domain Sequences for d1ob5e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ob5e2 b.44.1.1 (E:313-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus [TaxId: 271]}
htkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOPe Domain Coordinates for d1ob5e2:

Click to download the PDB-style file with coordinates for d1ob5e2.
(The format of our PDB-style files is described here.)

Timeline for d1ob5e2: