Lineage for d1ob5a1 (1ob5 A:213-312)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1544344Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 1544345Protein automated matches [226946] (16 species)
    not a true protein
  7. Species Thermus aquaticus [TaxId:271] [254881] (1 PDB entry)
  8. 1544405Domain d1ob5a1: 1ob5 A:213-312 [118691]
    Other proteins in same PDB: d1ob5a2, d1ob5a3, d1ob5c2, d1ob5c3, d1ob5e2, d1ob5e3
    automated match to d1b23p1
    protein/RNA complex; complexed with enx, gnp, mg

Details for d1ob5a1

PDB Entry: 1ob5 (more details), 3.1 Å

PDB Description: t. aquaticus elongation factor ef-tu complexed with the antibiotic enacyloxin iia, a gtp analog, and phe-trna
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1ob5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ob5a1 b.43.3.0 (A:213-312) automated matches {Thermus aquaticus [TaxId: 271]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvglllrgvsreevergqvlakpgsitp

SCOPe Domain Coordinates for d1ob5a1:

Click to download the PDB-style file with coordinates for d1ob5a1.
(The format of our PDB-style files is described here.)

Timeline for d1ob5a1: