Class b: All beta proteins [48724] (174 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Fungal alpha-amylase [51028] (2 species) |
Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (8 PDB entries) |
Domain d2taab1: 2taa B:382-478 [118672] Other proteins in same PDB: d2taaa2, d2taab2, d2taac2 duplicate of 2TAA A:382-478 complexed with ca |
PDB Entry: 2taa (more details), 3 Å
SCOPe Domain Sequences for d2taab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2taab1 b.71.1.1 (B:382-478) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} yknpyikddttiamrkgtdgsqivtilsnkgasgdsytlslsgasytagqqltevigctt vtvgsdgnvpvpmagglprvlypteklagskicsdss
Timeline for d2taab1:
View in 3D Domains from other chains: (mouse over for more information) d2taaa1, d2taaa2, d2taac1, d2taac2 |