SCOP 1.73: Domain d2lgsg1: 2lgs G:1-100

Lineage for d2lgsg1 (2lgs G:1-100)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family)

5. Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)

6. Protein Glutamine synthetase, N-terminal domain [54370] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)

8. Domain d2lgsg1: 2lgs G:1-100 [118658]
   Other proteins in same PDB: d2lgsa2, d2lgsb2, d2lgsc2, d2lgsd2, d2lgse2, d2lgsf2, d2lgsg2, d2lgsh2, d2lgsi2, d2lgsj2, d2lgsk2, d2lgsl2

Details for d2lgsg1

PDB Entry: 2lgs, 2.8 Å

PDB Description: feedback inhibition of fully unadenylylated glutamine synthetase from salmonella typhimurium by glycine, alanine, and serine

PDB Compounds: (G:) glutamine synthetase

SCOP Domain Sequences for d2lgsg1:

Sequence, based on SEQRES records:

>d2lgsg1 d.15.9.1 (G:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 602]}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

Sequence, based on observed residues (ATOM records):

>d2lgsg1 d.15.9.1 (G:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 602]}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
lmpdastavidpffadstliircdilepgtlqgy

Timeline for d2lgsg1:

• d2lgsg1 is new in SCOP 1.73
  
• d2lgsg1 appears in SCOP 1.75
  
• d2lgsg1 appears in the current release, SCOPe 2.08