Lineage for d2ldxd2 (2ldx D:160-331)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1938736Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1938743Protein Lactate dehydrogenase [56339] (18 species)
  7. 1938914Species Mouse (Mus musculus) [TaxId:10090] [56341] (1 PDB entry)
  8. 1938918Domain d2ldxd2: 2ldx D:160-331 [118647]
    Other proteins in same PDB: d2ldxa1, d2ldxb1, d2ldxc1, d2ldxd1
    duplicate of 2LDX 160-331

Details for d2ldxd2

PDB Entry: 2ldx (more details), 2.96 Å

PDB Description: characterization of the antigenic sites on the refined 3-angstroms resolution structure of mouse testicular lactate dehydrogenase c4
PDB Compounds: (D:) apo-lactate dehydrogenase

SCOPe Domain Sequences for d2ldxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ldxd2 d.162.1.1 (D:160-331) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]}
sgcnldsarfryligeklgvnptschgwvlgehgdssvpiwsgvnvagvtlkslnpaigt
dknkqhwknvhkqvveggyevldmkgytswaiglsvtdlarsilknlkrvhpvttlvkgf
hgikeevflsipcvlgesgitdfvkvnmtaeeegllkksadtlwnmqknlel

SCOPe Domain Coordinates for d2ldxd2:

Click to download the PDB-style file with coordinates for d2ldxd2.
(The format of our PDB-style files is described here.)

Timeline for d2ldxd2: