Lineage for d2ldxc2 (2ldx C:160-331)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1047016Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1047017Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 1047018Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 1047025Protein Lactate dehydrogenase [56339] (15 species)
  7. 1047090Species Mouse (Mus musculus) [TaxId:10090] [56341] (1 PDB entry)
  8. 1047093Domain d2ldxc2: 2ldx C:160-331 [118645]
    Other proteins in same PDB: d2ldxa1, d2ldxb1, d2ldxc1, d2ldxd1
    duplicate of 2LDX 160-331

Details for d2ldxc2

PDB Entry: 2ldx (more details), 2.96 Å

PDB Description: characterization of the antigenic sites on the refined 3-angstroms resolution structure of mouse testicular lactate dehydrogenase c4
PDB Compounds: (C:) apo-lactate dehydrogenase

SCOPe Domain Sequences for d2ldxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ldxc2 d.162.1.1 (C:160-331) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]}
sgcnldsarfryligeklgvnptschgwvlgehgdssvpiwsgvnvagvtlkslnpaigt
dknkqhwknvhkqvveggyevldmkgytswaiglsvtdlarsilknlkrvhpvttlvkgf
hgikeevflsipcvlgesgitdfvkvnmtaeeegllkksadtlwnmqknlel

SCOPe Domain Coordinates for d2ldxc2:

Click to download the PDB-style file with coordinates for d2ldxc2.
(The format of our PDB-style files is described here.)

Timeline for d2ldxc2: