Lineage for d1rsco_ (1rsc O:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2200260Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2200261Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2200262Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2200263Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 2200393Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [55246] (2 PDB entries)
  8. 2200408Domain d1rsco_: 1rsc O: [118625]
    Other proteins in same PDB: d1rsca1, d1rsca2, d1rscb1, d1rscb2, d1rscc1, d1rscc2, d1rscd1, d1rscd2, d1rsce1, d1rsce2, d1rscf1, d1rscf2, d1rscg1, d1rscg2, d1rsch1, d1rsch2
    duplicate of 1RSC M
    complexed with xbp

Details for d1rsco_

PDB Entry: 1rsc (more details), 2.3 Å

PDB Description: structure of an effector induced inactivated state of ribulose bisphosphate carboxylase(slash)oxygenase: the binary complex between enzyme and xylulose bisphosphate
PDB Compounds: (O:) ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)

SCOPe Domain Sequences for d1rsco_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rsco_ d.73.1.1 (O:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301 [TaxId: 1131]}
smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
lfdckspqqvldevrecrseygdcyirvagfdnikecqtvsfivhrpgr

SCOPe Domain Coordinates for d1rsco_:

Click to download the PDB-style file with coordinates for d1rsco_.
(The format of our PDB-style files is described here.)

Timeline for d1rsco_: