SCOPe 2.01: Domain d1rscf2: 1rsc F:9-147

Lineage for d1rscf2 (1rsc F:9-147)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)

7. Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [54973] (2 PDB entries)

8. Domain d1rscf2: 1rsc F:9-147 [118615]
   Other proteins in same PDB: d1rsca1, d1rscb1, d1rscc1, d1rscd1, d1rsce1, d1rscf1, d1rscg1, d1rsch1, d1rsci_, d1rscj_, d1rsck_, d1rscl_, d1rscm_, d1rscn_, d1rsco_, d1rscp_
   duplicate of 1RSC A:9-147
   complexed with xbp

Details for d1rscf2

PDB Entry: 1rsc, 2.3 Å

PDB Description: structure of an effector induced inactivated state of ribulose bisphosphate carboxylase(slash)oxygenase: the binary complex between enzyme and xylulose bisphosphate

PDB Compounds: (F:) ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)

SCOPe Domain Sequences for d1rscf2:

Sequence; same for both SEQRES and ATOM records:

>d1rscf2 d.58.9.1 (F:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301 [TaxId: 1131]}
saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
vwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgnvfgfk
airslrledirfpvalvkt

Timeline for d1rscf2:

• d1rscf2 first appeared in SCOP 1.73
  
• d1rscf2 appears in SCOP 1.75
  
• d1rscf2 appears in SCOPe 2.02
  
• d1rscf2 appears in the current release, SCOPe 2.08