Lineage for d1rscb2 (1rsc B:9-147)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1416218Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 1416219Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 1416220Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 1416427Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [54973] (2 PDB entries)
  8. 1416437Domain d1rscb2: 1rsc B:9-147 [118607]
    Other proteins in same PDB: d1rsca1, d1rscb1, d1rscc1, d1rscd1, d1rsce1, d1rscf1, d1rscg1, d1rsch1, d1rsci_, d1rscj_, d1rsck_, d1rscl_, d1rscm_, d1rscn_, d1rsco_, d1rscp_
    duplicate of 1RSC A:9-147
    complexed with xbp

Details for d1rscb2

PDB Entry: 1rsc (more details), 2.3 Å

PDB Description: structure of an effector induced inactivated state of ribulose bisphosphate carboxylase(slash)oxygenase: the binary complex between enzyme and xylulose bisphosphate
PDB Compounds: (B:) ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)

SCOPe Domain Sequences for d1rscb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rscb2 d.58.9.1 (B:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301 [TaxId: 1131]}
saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
vwtdlltdmdrykgkcyhiepvqgeensyfafiaypldlfeegsvtniltsivgnvfgfk
airslrledirfpvalvkt

SCOPe Domain Coordinates for d1rscb2:

Click to download the PDB-style file with coordinates for d1rscb2.
(The format of our PDB-style files is described here.)

Timeline for d1rscb2: