SCOPe 2.01: Domain d1rblb2: 1rbl B:9-147

Lineage for d1rblb2 (1rbl B:9-147)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)

7. Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [54973] (2 PDB entries)

8. Domain d1rblb2: 1rbl B:9-147 [118586]
   Other proteins in same PDB: d1rbla1, d1rblb1, d1rblc1, d1rbld1, d1rble1, d1rblf1, d1rblg1, d1rblh1, d1rbli_, d1rblj_, d1rblk_, d1rbll_, d1rblm_, d1rbln_, d1rblo_, d1rblp_
   duplicate of 1RBL A:9-147
   complexed with cap, fmt, mg

Details for d1rblb2

PDB Entry: 1rbl, 2.2 Å

PDB Description: structure determination and refinement of ribulose 1,5 bisphosphate carboxylase(slash)oxygenase from synechococcus pcc6301

PDB Compounds: (B:) ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)

SCOPe Domain Sequences for d1rblb2:

Sequence; same for both SEQRES and ATOM records:

>d1rblb2 d.58.9.1 (B:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301 [TaxId: 1131]}
saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
vwtdlltdmdrykgkcyhiepvageensyfafiaypldlfeegsvtniltsivgnvfgfk
airslrledirfpvalvkt

Timeline for d1rblb2:

• d1rblb2 first appeared in SCOP 1.73
  
• d1rblb2 appears in SCOP 1.75
  
• d1rblb2 appears in SCOPe 2.02
  
• d1rblb2 appears in the current release, SCOPe 2.08