Lineage for d1ldbd2 (1ldb D:163-331)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2232530Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2232537Protein Lactate dehydrogenase [56339] (19 species)
  7. 2232543Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries)
  8. 2232559Domain d1ldbd2: 1ldb D:163-331 [118528]
    Other proteins in same PDB: d1ldba1, d1ldbb1, d1ldbc1, d1ldbd1
    duplicate of 1LDB 163-331
    complexed with so4

Details for d1ldbd2

PDB Entry: 1ldb (more details), 2.8 Å

PDB Description: structure determination and refinement of bacillus stearothermophilus lactate dehydrogenase
PDB Compounds: (D:) apo-l-lactate dehydrogenase

SCOPe Domain Sequences for d1ldbd2:

Sequence, based on SEQRES records: (download)

>d1ldbd2 d.162.1.1 (D:163-331) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea
qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge
rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraftr

Sequence, based on observed residues (ATOM records): (download)

>d1ldbd2 d.162.1.1 (D:163-331) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpidlerifvnvrd
aayqiiekkgatyygiamglarvtrailhnenailtvsayldglygerdvyigvpavinr
ngirevieielnddeknrfhhsaatlksvlaraftr

SCOPe Domain Coordinates for d1ldbd2:

Click to download the PDB-style file with coordinates for d1ldbd2.
(The format of our PDB-style files is described here.)

Timeline for d1ldbd2: