Lineage for d1hcyd1 (1hcy D:1-135)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644692Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily)
    6 helices; bundle; one central helix is surrounded by 5 others
  4. 644693Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family) (S)
  5. 644694Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein)
  6. 644695Protein Hemocyanin, N-terminal domain [48052] (2 species)
    Middle domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich
  7. 644701Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48054] (7 PDB entries)
  8. 644711Domain d1hcyd1: 1hcy D:1-135 [118493]
    Other proteins in same PDB: d1hcya2, d1hcya3, d1hcyb2, d1hcyb3, d1hcyc2, d1hcyc3, d1hcyd2, d1hcyd3, d1hcye2, d1hcye3, d1hcyf2, d1hcyf3
    duplicate of 1HCY 1-135
    complexed with cu, nag

Details for d1hcyd1

PDB Entry: 1hcy (more details), 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution
PDB Compounds: (D:) arthropodan hemocyanin

SCOP Domain Sequences for d1hcyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcyd1 a.85.1.1 (D:1-135) Hemocyanin, N-terminal domain {Spiny lobster (Panulirus interruptus) [TaxId: 6735]}
dalgtgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkel
ndhrlleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyaly
vsvihsklgdgivlp

SCOP Domain Coordinates for d1hcyd1:

Click to download the PDB-style file with coordinates for d1hcyd1.
(The format of our PDB-style files is described here.)

Timeline for d1hcyd1: