Lineage for d1h68a1 (1h68 A:2-218)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022990Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 3022991Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 3022992Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)
  6. 3023161Protein Sensory rhodopsin II [64526] (1 species)
  7. 3023162Species Natronobacterium pharaonis [TaxId:2257] [64527] (14 PDB entries)
  8. 3023167Domain d1h68a1: 1h68 A:2-218 [118486]
    complexed with cl, ret

Details for d1h68a1

PDB Entry: 1h68 (more details), 2.1 Å

PDB Description: sensory rhodopsin ii
PDB Compounds: (A:) sensory rhodopsin II

SCOPe Domain Sequences for d1h68a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h68a1 f.13.1.1 (A:2-218) Sensory rhodopsin II {Natronobacterium pharaonis [TaxId: 2257]}
vglttlfwlgaigmlvgtlafawagrdagsgerryyvtlvgisgiaavayvvmalgvgwv
pvaertvfapryidwilttplivyflgllagldsrefgivitlntvvmlagfagamvpgi
eryalfgmgavaflglvyylvgpmtesasqrssgikslyvrlrnltvilwaiypfiwllg
ppgvalltptvdvalivyldlvtkvgfgfialdaaat

SCOPe Domain Coordinates for d1h68a1:

Click to download the PDB-style file with coordinates for d1h68a1.
(The format of our PDB-style files is described here.)

Timeline for d1h68a1: