SCOP 1.73: Domain d1guhd1: 1guh D:81-222

Lineage for d1guhd1 (1guh D:81-222)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (17 PDB entries)

8. Domain d1guhd1: 1guh D:81-222 [118484]
   Other proteins in same PDB: d1guha2, d1guhb2, d1guhc2, d1guhd2
   duplicate of 1GUH A:81-222
   complexed with gsb

Details for d1guhd1

PDB Entry: 1guh, 2.6 Å

PDB Description: Structure determination and refinement of human alpha class glutathione transferase A1-1, and a comparison with the MU and PI class enzymes

PDB Compounds: (D:) glutathione s-transferase a1-1

SCOP Domain Sequences for d1guhd1:

Sequence; same for both SEQRES and ATOM records:

>d1guhd1 a.45.1.1 (D:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

Timeline for d1guhd1:

• d1guhd1 is new in SCOP 1.73
  
• d1guhd1 appears in SCOP 1.75
  
• d1guhd1 appears in the current release, SCOPe 2.08