Lineage for d1gsfd1 (1gsf D:81-222)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1735627Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1735638Protein Class alpha GST [81349] (8 species)
  7. 1735651Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (27 PDB entries)
    Uniprot P08263
  8. 1735717Domain d1gsfd1: 1gsf D:81-222 [118480]
    Other proteins in same PDB: d1gsfa2, d1gsfb2, d1gsfc2, d1gsfd2
    duplicate of 1GSF A:81-222
    complexed with eaa

Details for d1gsfd1

PDB Entry: 1gsf (more details), 2.7 Å

PDB Description: glutathione transferase a1-1 complexed with ethacrynic acid
PDB Compounds: (D:) glutathione transferase a1-1

SCOPe Domain Sequences for d1gsfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsfd1 a.45.1.1 (D:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

SCOPe Domain Coordinates for d1gsfd1:

Click to download the PDB-style file with coordinates for d1gsfd1.
(The format of our PDB-style files is described here.)

Timeline for d1gsfd1: