Lineage for d1grlg3 (1grl G:137-190,G:367-409)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203618Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 1203619Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 1203620Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 1203621Protein GroEL, I domain [54851] (4 species)
  7. 1203622Species Escherichia coli [TaxId:562] [54852] (9 PDB entries)
  8. 1203706Domain d1grlg3: 1grl G:137-190,G:367-409 [118473]
    Other proteins in same PDB: d1grla1, d1grla2, d1grlb1, d1grlb2, d1grlc1, d1grlc2, d1grld1, d1grld2, d1grle1, d1grle2, d1grlf1, d1grlf2, d1grlg1, d1grlg2
    duplicate of 1GRL 137-190,367-409

Details for d1grlg3

PDB Entry: 1grl (more details), 2.8 Å

PDB Description: the crystal structure of the bacterial chaperonin groel at 2.8 angstroms
PDB Compounds: (G:) groEL (hsp60 class)

SCOPe Domain Sequences for d1grlg3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grlg3 d.56.1.1 (G:137-190,G:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOPe Domain Coordinates for d1grlg3:

Click to download the PDB-style file with coordinates for d1grlg3.
(The format of our PDB-style files is described here.)

Timeline for d1grlg3: