| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) ![]() |
| Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
| Protein Immunoglobulin-binding protein G, different constituent domains [54360] (3 species) |
| Species Streptococcus sp., group G [TaxId:1306] [54361] (31 PDB entries) |
| Domain d1fccd_: 1fcc D: [118453] Other proteins in same PDB: d1fcca1, d1fcca2, d1fccb1, d1fccb2 duplicate of 1FCC C |
PDB Entry: 1fcc (more details), 3.2 Å
SCOPe Domain Sequences for d1fccd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fccd_ d.15.7.1 (D:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
ttyklvingktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte
Timeline for d1fccd_: