SCOP 1.73: Domain d1fccd_: 1fcc D:

Lineage for d1fccd_ (1fcc D:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (28 PDB entries)

8. Domain d1fccd_: 1fcc D: [118453]
   Other proteins in same PDB: d1fcca1, d1fcca2, d1fccb1, d1fccb2
   duplicate of 1FCC C

Details for d1fccd_

PDB Entry: 1fcc, 3.5 Å

PDB Description: crystal structure of the c2 fragment of streptococcal protein g in complex with the fc domain of human igg

PDB Compounds: (D:) streptococcal protein g (c2 fragment)

SCOP Domain Sequences for d1fccd_:

Sequence; same for both SEQRES and ATOM records:

>d1fccd_ d.15.7.1 (D:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
ttyklvingktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte

Timeline for d1fccd_:

• d1fccd_ is new in SCOP 1.73
  
• d1fccd_ appears in SCOP 1.75
  
• d1fccd_ appears in the current release, SCOPe 2.08