Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88590] (26 PDB entries) |
Domain d1fccb2: 1fcc B:342-443 [118452] Other proteins in same PDB: d1fcca1, d1fccb1, d1fccc_, d1fccd_ duplicate of 1FCC A:342-443 |
PDB Entry: 1fcc (more details), 3.5 Å
SCOP Domain Sequences for d1fccb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fccb2 b.1.1.2 (B:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl
Timeline for d1fccb2:
View in 3D Domains from other chains: (mouse over for more information) d1fcca1, d1fcca2, d1fccc_, d1fccd_ |