SCOPe 2.06: Domain d1cdeb_: 1cde B:

Lineage for d1cdeb_ (1cde B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest

4. Superfamily c.65.1: Formyltransferase [53328] (2 families)

5. Family c.65.1.1: Formyltransferase [53329] (5 proteins)

6. Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)

7. Species Escherichia coli [TaxId:562] [53331] (9 PDB entries)

8. Domain d1cdeb_: 1cde B: [118439]
   duplicate of 1CDE
   complexed with dzf, gar

Details for d1cdeb_

PDB Entry: 1cde, 2.5 Å

PDB Description: structures of apo and complexed escherichia coli glycinamide ribonucleotide transformylase

PDB Compounds: (B:) phosphoribosyl-glycinamide formyltransferase

SCOPe Domain Sequences for d1cdeb_:

Sequence; same for both SEQRES and ATOM records:

>d1cdeb_ c.65.1.1 (B:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
iswfadgrlkmhenaawldgqrlppqgya

Timeline for d1cdeb_:

• d1cdeb_ first appeared in SCOP 1.73
  
• d1cdeb_ appears in SCOPe 2.05
  
• d1cdeb_ appears in SCOPe 2.07
  
• d1cdeb_ appears in the current release, SCOPe 2.08