Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) |
Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species) |
Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries) |
Domain d1aust_: 1aus T: [118415] Other proteins in same PDB: d1ausl1, d1ausl2, d1ausm1, d1ausm2, d1ausn1, d1ausn2, d1auso1, d1auso2 duplicate of 1AUS S complexed with fmt, mg |
PDB Entry: 1aus (more details), 2.2 Å
SCOPe Domain Sequences for d1aust_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aust_ d.73.1.1 (T:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]} mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp agy
Timeline for d1aust_: